DPCstruct | MC30897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 217 ± 35 aa |
| Standard deviation of domain lengths | 35.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 38.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4UEI5 | 215-445 | KCGSTEIDGFVFWSGLQSLLWGSQNPVRPVTYLIKEAIFRPRRTKMSSGRFSLGISSLGELIDMYHTHEATERHDRIFALLGMASDD… |
| A0A428UHT9 | 1-258 | MCHSTEIEGHAFCSGLKHLDLSEAPAVQSRIKSAVYLIKDAVFRPKAVASSSDRFSLGIASLGQLVDMYHNREATDRQDKVYALLGM… |
| A0A2P4ZMV6 | 78-325 | None |
| A0A084B5Y1 | 338-518 | None |
| A0A0L1JGK5 | 18-255 | None |
| G4UU46 | 1-185 | None |
| A0A317XDT2 | 206-447 | None |
| A0A401L1W7 | 7-224 | None |
| A0A0F0I8F6 | 1-194 | None |
| A0A1M3TCI2 | 158-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.