DPCstruct | MC30891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 4.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0123- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S9E2L8 | 2-66 | DKDGKLTLRYGGQLRHLGMGRTYSGVPVRMLIDDRDVTVINRKTGEIIRYFKIEPSKNYQKAISR |
| A0A512T0I7 | 2-72 | RTDKVHTGKITLRHGGTLYSIGIGRHHNGTTVKALVNGLDITIIDATTGEVLRQLTLDTTRKYQPQKPQHP |
| A0A238WVN4 | 128-192 | None |
| A0A653QY99 | 4-81 | None |
| A0A1A3E0G1 | 1-67 | None |
| A0A0M2HXD7 | 154-223 | None |
| U7KZE5 | 1-66 | None |
| A0A838H678 | 14-91 | None |
| A0A1H0DSD1 | 132-198 | None |
| D9QC53 | 66-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.