DPCstruct | MC3089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 388 ± 61 aa |
| Standard deviation of domain lengths | 61.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8DSJ1 | 164-494 | LNSSSECASIAADEFPSNCPGQFPFLTDYTGNGISIRVCVPDGKDGKPWGAMRDRQDIEEEMYLDARLASDAGDATLNDDFQNFTIL… |
| A0A366PF65 | 38-366 | LNSSSECASIAADEFPSNCPGQFPFLTDYTGNGISIRVCVQDGKDGKPWGAMRDRQDIEEEMYLDARLASDAGDATLNDDFQNFTIL… |
| A0A2I0RQ71 | 10-334 | None |
| A0A4Q4MBR8 | 2-462 | None |
| A0A6M7YY44 | 2-363 | None |
| A0A2L2SS20 | 1-328 | None |
| A0A1L9PK29 | 296-632 | None |
| A0A094H1W2 | 211-653 | None |
| A0A194VRP1 | 128-588 | None |
| A0A507B3X3 | 265-719 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.