DPCstruct | MC30889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379X3D0 | 36-113 | NQIFDIWVRRDVDRVYVQMFDVALAAWTAQQPVLCVHSETCGHAFALESNGDLYNCDHFVYREHLLGNIHQHSIKALN |
| A0A0J1FJ66 | 58-143 | AVFDEWIRHDLGRLDVQLFAEMALVWSGGNASLCWMAPTCGRVLIVEHDGSVYSCDHFVNPDHRIGNIEASPLSALVDLPVQRRFG |
| A0A090SB55 | 72-168 | None |
| A0A1F2U7I9 | 2-81 | None |
| A0A7V5PA52 | 310-395 | None |
| R6Y0F9 | 75-155 | None |
| A0A2E0UNX9 | 18-97 | None |
| A0A160VPN8 | 79-163 | None |
| A0A1V5NHK0 | 29-114 | None |
| A0A1V5FD02 | 77-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.