DPCstruct | MC30886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 114 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 91.82 |
| Assigned Pfam label(s) | PF00199- PF06628 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379WWU1 | 4-123 | MDIDTNPANYEPNSINDNWPRETPPAPKRGGFESYQERVDGNKIRERSPSFGEYYSHPRLFWLSQTPIEQQHIIDAFSFELGKVARA… |
| A0A6N6X853 | 34-135 | MHRMDIDTNPANYEPNSINDNWPRETPPGPKRGGFESYQERIEGNKIRERSPSFGEYYAHPRLFWLSQTPIEQQHIIGGFSFELSKV… |
| A0A1Q5QB27 | 771-885 | None |
| A0A0D0AY96 | 342-460 | None |
| A0A4S8L7X7 | 202-325 | None |
| A0A6V7R0I2 | 1-118 | None |
| A0A2A3HPH6 | 152-270 | None |
| A0A5D3B531 | 162-279 | None |
| A0A401KK24 | 943-1057 | None |
| A0A2S6GIB5 | 64-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.