DPCstruct | MC3088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 14 aa |
| Standard deviation of domain lengths | 13.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820NGZ6 | 15-79 | FFVEPSTTAGKLNTADWPLLLKNFDRLNIRSNHYTPIAAGCSPLQRPIEDYIKSGFINLDKPVNP |
| A0A366NUC7 | 1-80 | MTMEIVKHGEEEEYSIKPQAATPQLDTSSWPLLLKNYDKLLVRTGHFTPIPAGCSPLKRDIKSYISSGVINLDKPSNVRS |
| A0A6G3MG54 | 2-77 | None |
| A0A836DBM5 | 16-83 | None |
| T1L5C9 | 1-96 | None |
| A0A4U0XZ26 | 1-78 | None |
| A0A1C7MVN3 | 1-66 | None |
| A0A0X3NYZ6 | 1-108 | None |
| A0A3Q0T309 | 4-102 | None |
| A0A199W1L1 | 34-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.