DPCstruct | MC30878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 124 ± 22 aa |
| Standard deviation of domain lengths | 22.16 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.05 |
| Pfam Score | 96.83 |
| Assigned Pfam label(s) | CL0063- PF00572- CL0300- CL0329- CL0067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3HXH1 | 75-188 | LPGGFAAQTITGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYVKVPLVTLGYETSYDVFVKAHGGGLSGQAQAISLG… |
| A0A379WKK4 | 5-125 | QYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD… |
| A0A059BCX8 | 6-121 | None |
| A0A0B3AII2 | 2-98 | None |
| A0A5F7ZTS9 | 4-111 | None |
| A0A1W0XAK7 | 258-381 | None |
| A0A7J6PT04 | 377-463 | None |
| A0A1I8ICR8 | 745-899 | None |
| A0A7R9KY40 | 63-224 | None |
| E0CQ91 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.