DPCstruct | MC30876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 152 ± 32 aa |
| Standard deviation of domain lengths | 31.87 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379WHK6 | 24-151 | MRRLRQLIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVDFVPVRFTSWMGGDRDGNPNVTA… |
| A0A3S4K406 | 2-134 | RRLRQLIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVDFVPVRFTSWMGGDRDGNPNVTAD… |
| A0A6D0EJG7 | 136-292 | None |
| A0A453EF89 | 157-314 | None |
| A0A2I0AHV6 | 331-471 | None |
| A0A376TPJ5 | 83-238 | None |
| A0A855HTE0 | 1-116 | None |
| A0A446U7E8 | 76-313 | None |
| A0A5J5AQ85 | 139-344 | None |
| W4LNC7 | 195-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.