DPCstruct | MC30873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 4.35 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T5CJD4 | 125-204 | LLAEIGGKSGFQIDIVPTCDVVLSNHHIVRVSSSLVRWLIEKGRVADAEIAIGRPYTFESIVVTGEKVGRQLGFPTSILI |
| A0A379WG43 | 1-83 | MLLQKGGAEYGFAVSSTQTFCEGGVRISSTAVRQALAEDNLALAESLLGHPFTISGRVVHGDELGRTIGFPTANLPLRRQVSR |
| A0A2G6NTM6 | 21-95 | None |
| A0A388Q5E8 | 1-77 | None |
| A0A837Q674 | 141-209 | None |
| A0A1A9X6D2 | 61-144 | None |
| A0A7J6ZJR1 | 68-145 | None |
| A0A3S5EYU8 | 67-144 | None |
| A0A5E4MFF0 | 94-169 | None |
| A0A833KNS6 | 69-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.