DPCstruct | MC3087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 155 ± 23 aa |
| Standard deviation of domain lengths | 23.12 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A425BRZ2 | 19-179 | AGTPFQGALDGFPVNPYDPFCAMSCLRSLYTLILSCSSTGDTVGMMTMTTTSACWAENTPYLTSLAWCMHIKCSEYNITNSKLEYFW… |
| A0A366NT72 | 1-141 | MYKLPCAFACNGAISNNALSCSSMMEMEGMDDMPATTPECRANDTSFLTTLAWCFKSKCAEFNVPVSKLQKFWEEEATGEPTAPPEW… |
| A0A7S8HRY5 | 33-187 | None |
| A0A420QFK0 | 18-173 | None |
| A0A4T0VSD3 | 1-155 | None |
| A0A420SBI4 | 23-171 | None |
| W7MTA3 | 1-100 | None |
| A0A084R529 | 3-186 | None |
| A0A1Y2U936 | 15-187 | None |
| A0A4Q2VUD6 | 13-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.