DPCstruct | MC30867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 9.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12321 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3JHG5 | 104-195 | TLLTLLLLVVVLVVPFVVLLRRANELFVLEVRGGQITVVRGKPPASLLRDLRDVVRGVPAARLVARREQGRPMLRATGLSEAQLQRA… |
| A0A5Q4FNL7 | 5-99 | LLLMFAILALGAGLLIWHARIAFVVKLQDGKAQAQRGTPPPDFLRGCGDVARMYGIKQGRIRGIRSGQGIRLSFSRDIPEHTHQPFR… |
| A0A7Y0RPP7 | 7-84 | None |
| A0A017TCA9 | 6-109 | None |
| A0A7T4YKB2 | 4-84 | None |
| A0A327WYR5 | 27-118 | None |
| A0A356TBI0 | 18-99 | None |
| A0A1V5XTC4 | 23-125 | None |
| A0A7V8QKE2 | 4-77 | None |
| A0A1L6LVA0 | 2-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.