DPCstruct | MC30858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 14 aa |
| Standard deviation of domain lengths | 13.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 35.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674AWB1 | 1-158 | MHKSYQPLKPATNKYLQKKWDQTRYEEHRNKLSTARPIVDTKGIRTPAHVQLKLKKLQLQDERLVTIERDNRLLSSKLSDIVRSKGL… |
| A0A0L8GHE9 | 1-155 | MHKSYQTVLPCQSRLLQQRWDKAYYLEHRRKVATVVPMIDNKPPPNFMHLHLKMKKLQLEEEHLATIERDNHRLLERMGYIMRTRGR… |
| A0A6J0UMZ2 | 1-156 | None |
| H2ZWY0 | 1-155 | None |
| A0A671U421 | 9-166 | None |
| A0A3P8RZC7 | 2-150 | None |
| A0A5J4NV54 | 4-138 | None |
| A0A024U1H0 | 1-175 | None |
| A0A4Y2D7D7 | 1-170 | None |
| A0A1V4J468 | 62-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.