DPCstruct | MC30857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 304 ± 38 aa |
| Standard deviation of domain lengths | 38.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B7DHQ6 | 3-244 | NGHLLLSIKGSLVWGAGVKGYLTFEVGYDSIVALTELVRQEMAANQYKDLEWVDGEAMDYLQKLSFLGATGIDVAFAYVRGYAIVKG… |
| A0A0D1F0K6 | 51-364 | FAGMQANGQLVGGVEWLPPKNASSSTDEPEGNQKESKEAEFQALAEVKPEGNIAFGVGVNAEFQLALEGGKFYVKCSGQIVCGFGAG… |
| A0A1Y6IYI6 | 472-743 | None |
| A0A1V3H6R3 | 234-576 | None |
| A0A375C764 | 408-722 | None |
| A0A2N6FMY8 | 439-730 | None |
| A0A7Z2RN30 | 491-833 | None |
| A0A4P7BJP4 | 23-320 | None |
| A6VUJ2 | 490-842 | None |
| A0A317ZWI6 | 426-772 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.