DPCstruct | MC30854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 142 ± 24 aa |
| Standard deviation of domain lengths | 24.15 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 21.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2J9W2 | 31-171 | AEAEEAAEAATPAPAKPAPVAAAPKPAPKPICSNCGTVSNIEAVTEKGQGSGIGAIAGAVAGGVIGHQFGSGSGNKAATAAGAIGGG… |
| A0A6J4ING1 | 22-147 | PDTYATRAVQQANKVEQGMLVGRREVNITAEGTTGAATGAAAGGVLGAQAPGGGIGSALGGVGGALIGGLIGTTAEHVAGDTKAFEY… |
| A0A3D3S6M3 | 1-111 | None |
| F3KCY2 | 1-100 | None |
| A0A272EYZ9 | 12-160 | None |
| A0A519G6A9 | 59-233 | None |
| A0A6P1IMG0 | 30-178 | None |
| A0A2Z6G881 | 69-193 | None |
| A0A5C7TGR6 | 54-218 | None |
| A0A2A3VHL3 | 8-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.