DPCstruct | MC30853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 139 |
|---|---|
| Mean domain length (aa) | 127 ± 27 aa |
| Standard deviation of domain lengths | 26.81 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.27 |
| Pfam Score | 94.75 |
| Assigned Pfam label(s) | CL0023- PF02272- PF01018- CL0127- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N8F461 | 1-84 | DGGNGGKGGDIVFEAVAGLNTLIDFRYTQHFRAPRGNGGAGSNRTGAGGDDLVIKVPVGTQILADDEERTLLLDMVKVGQREIF |
| A8V5C1 | 2-109 | FVDKAKIYVKAGDGGRGCVAWRREKFVPMGGPAGGNGGKGGDVILKADNRLQTLYDFKHKVHFKADRGQHGSGSNKHGRNAEDLIIK… |
| R1D1N7 | 86-261 | None |
| A0A3S3Q0V8 | 141-291 | None |
| A0A0E0MID4 | 47-139 | None |
| Q4MYP6 | 17-147 | None |
| Q4N914 | 198-286 | None |
| A0A5J4YLG7 | 197-337 | None |
| A0A553IF12 | 69-161 | None |
| A0A4W6EVU4 | 71-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.