DPCstruct | MC30852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Standard deviation of domain lengths | 9.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XFE1 | 2-79 | LFLTNGGGVPEHKRALELSELLGVNISPAQVVHGHSPYRDLVKRFEDDLIVAVGKGEPASVMAEYGFRKVLSIDEYSS |
| A0A819H0J2 | 46-122 | IFVTNASNELHTSKAAKLTQILEIPILPEQVIVAHSPLKMYTEFHKKHCLISGQGPIADIAKNLGFTKVTTIEQLCD |
| A0A6L2Q151 | 38-123 | None |
| A0A817EKK3 | 41-126 | None |
| A0A2H5NZ45 | 65-132 | None |
| A0A1V9Y7E6 | 40-135 | None |
| A0A485KYU9 | 48-148 | None |
| G3PAA2 | 2-83 | None |
| U9TGE7 | 11-89 | None |
| A0A068U9P2 | 66-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.