DPCstruct | MC30851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 489 ± 89 aa |
| Standard deviation of domain lengths | 89.12 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.61 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0662- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7FPR1 | 8-397 | QPGPHAVQPLLKHIKKKAKMREQERQAAGGGDMFFMRTPQDLTGKDGDLILAEYSEEYPPLIMQVGMASKIKNYYKRKPGKDPGAPD… |
| A0A4P9W7X5 | 1-441 | MGPLLFFTPFQLSNSTAPSPCTFSRVRAIKKKKLKGKEPADVLRNPKDLTLKEISAYILLEYSEEYPPMMSNTGMATLMYNYYRKKD… |
| A0A5S6Q4V2 | 1-436 | None |
| A0A813UCJ3 | 131-767 | None |
| R1BWK4 | 57-526 | None |
| A0A6G0SHS0 | 1-715 | None |
| A0A4Y2LWS0 | 342-960 | None |
| A0A452XC55 | 1-465 | None |
| A0A061RW54 | 126-612 | None |
| A0A4Z2AYJ9 | 250-731 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.