DPCstruct | MC30847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 8.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1AN48 | 3-87 | IIFPDQPPHYDADRLALTFPATAGGMHVECAVTAEALEDHFGAASLLETDLRGAFLAHRAAIERAAARMIEATQSEAITLHSGYF |
| A0A328XHQ1 | 2-94 | FIHFSDTAATCSPKGSVVFVAMVDATEVNCEVSPEALADHFGAKRMDPPCLLAAFEAHRREILATAAAMLPHRLSGRRCLLFSRDFS… |
| A0A7I8CMX9 | 127-212 | None |
| A0A7S7QMN1 | 62-159 | None |
| A0A1L6I724 | 1-71 | None |
| A0A1H6PBN9 | 107-196 | None |
| A0A4R5QDX0 | 5-95 | None |
| A0A7W6YTZ9 | 28-132 | None |
| X5UQ10 | 1-73 | None |
| A0A3C1ND29 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.