DPCstruct | MC30843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 367 ± 46 aa |
| Standard deviation of domain lengths | 45.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N8IG64 | 7-379 | KSSSVTSPVSRKQRKTVLVSGRVVEAQLLEISWQGGVTVTRKQSAVAAPHWTSEASVVEIEKPDEFCHANGSQRPGAYLVKSKAGAN… |
| A0A7V2Z1F6 | 366-683 | VLVEVTNIKFNHDPASTANDAINIRQDYSTPYDITNGEWIKGGANLPACYITSKTVTIKARFSVNLTTVTSADVSADSTDHHGTLGD… |
| A0A6A6AEW7 | 6-445 | None |
| A0A847JXX3 | 22-346 | None |
| A0A1B9NA30 | 1-424 | None |
| A0A7C5NP87 | 11-435 | None |
| A0A836S8I4 | 51-480 | None |
| A0A3L7P0V0 | 17-353 | None |
| A0A661ZY12 | 233-572 | None |
| A0A317ZML5 | 1-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.