DPCstruct | MC30842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 114 ± 23 aa |
| Standard deviation of domain lengths | 23.39 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4F4L5 | 45-148 | SDSSGIAKDFSKDGRGRRPSVATLSQLQSGSLGELVVYRSGRVMMELNGFRIEVQPGTDSAFDQELAAINTPSDANAPVDMLRLGKL… |
| A0A2P6RFM1 | 1-66 | MGKMLVYKSGAVKFKLGDALYDVSPGSDCIFSQDVAAINTAARKCCVLGELGQRVVITPDVDSLLD |
| A0A5J4VJ62 | 10-94 | None |
| I2H5W8 | 264-379 | None |
| A8JGL9 | 16-103 | None |
| A0A5B7DR81 | 18-104 | None |
| A0A0H2S3S9 | 86-211 | None |
| A0A0C9YZ32 | 11-122 | None |
| A0A7S1SZ76 | 87-198 | None |
| M8AK53 | 454-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.