DPCstruct | MC3084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 56 ± 7 aa |
| Standard deviation of domain lengths | 6.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 69.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3GF27 | 1-66 | MEPVDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGDSCIFLFTGFILPTQ |
| A0A341BRG2 | 76-128 | RLLPAGLRGDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDD |
| A0A6P6XUY8 | 5-56 | None |
| A0A3B4C6E0 | 1-61 | None |
| A0A7M4EYA3 | 40-100 | None |
| A0A836D047 | 2-58 | None |
| A0A673Z035 | 15-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.