DPCstruct | MC30831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9VRH3 | 2-53 | RPLDTDEPTVVGPYRLLGRLGSGGMGRVYLGRSAGGRTVAVKIVHPHFALDE |
| A0A0M8U9Q4 | 13-63 | TALAADDPYEIGGYRLHARLGAGGTGVVYLAYTPGGRPIAPKAVRRAACPD |
| A0A5M3W0N3 | 100-167 | None |
| E3IWN2 | 5-61 | None |
| E3JA22 | 72-135 | None |
| A0A6M4PH29 | 10-73 | None |
| A0A4V2XGK9 | 352-416 | None |
| A0A1D7Y2C8 | 273-336 | None |
| A0A561EKW8 | 1-60 | None |
| A0A7W0HTG3 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.