DPCstruct | MC30828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 214 ± 23 aa |
| Standard deviation of domain lengths | 22.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G3H5A8 | 34-259 | MSYDFILFSPDRDANNQVVVDNRVFSLNEQLMRRYSCTSTTSSPELDVLVDKINHDVEKLPGLEGASVEGDRIIRVNTTIQAQERAL… |
| A0A4R4RRH7 | 1-238 | MSFDLCVWRENHPITGAQALRTYWWLCGSERLGAADESEFTLAHDERVDAFHTELLDAHPPLEGLDTAEAEDSPWSMTPDHMPGSYV… |
| A0A2T5J1N1 | 1-231 | None |
| A0A2T5J440 | 1-251 | None |
| A0A5C9CMV0 | 2-229 | None |
| C6WD28 | 3-211 | None |
| A0A4Y7B277 | 1-212 | None |
| A0A1V2TCL9 | 7-197 | None |
| I0H8Q8 | 2-187 | None |
| A0A849BHV5 | 1-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.