DPCstruct | MC30823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 82 ± 4 aa |
| Standard deviation of domain lengths | 3.67 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9IWV1 | 117-199 | GLDAWDDWSVAGVAYILERYNGFGYRRRTPPVPSPYLWSFTTVYVSGKYVADHTWSDTAVSKQCGGMALLLALRDAGEINVAD |
| A0A2V2R5C7 | 299-379 | GRNVGDWTLGSVLDASEAYNGFGYRRKGFTSPFIWGCTNIYKGGMFLRDHTFQNIESKACGVAAIIKMMFEAGDVNLPRSK |
| A0A7R6XU05 | 50-133 | None |
| A0A2U3PXH0 | 813-892 | None |
| A0A0A1VPE4 | 48-136 | None |
| A0A5B8G1P2 | 240-324 | None |
| A0A5E7L165 | 67-142 | None |
| A0A3C0MEW0 | 270-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.