DPCstruct | MC3082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 209 ± 31 aa |
| Standard deviation of domain lengths | 31.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6CCU2 | 37-242 | TKIQLPDVPRSYMRIIPAGWNTHPPSVADIATLHNGMRVEAPHDGAASGDFGATEEGFVRYWLTGEYGQPSSTSNVTMFFEDTGEFW… |
| A0A2U3LWH4 | 2-203 | ELCHFPVDSFISRSQPELLSAARQAQVFAHARPTGVVREDSRPRPTNEGILARVSVPDPDTRGRFLAYWNLTKGGDFYTLMSLTEDE… |
| A0A2V9WWA4 | 11-193 | None |
| F0C1K4 | 1-199 | None |
| A0A0Q4IW80 | 3-174 | None |
| A0A0F9KIF2 | 166-379 | None |
| A0A5N0V5H7 | 67-270 | None |
| A0A845JNC8 | 1-179 | None |
| A0A4C2ENC1 | 21-206 | None |
| A0A3S9V9F9 | 340-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.