DPCstruct | MC30813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 274 ± 47 aa |
| Standard deviation of domain lengths | 47.25 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2A0Y4 | 1-217 | MEQGYRSEVQERALVVSLQMFSLILERGVSLLKAQLDSGQEPRLVVGEDLQVLLPAIKIWCDWMLCHSTVWNPPPSCTDYRVGPPGD… |
| A0A834NJ31 | 1-282 | MEQGYRSEVQERALIVSLQMFSLILERGVSLLKTQLDCGEEPRLVVGEDMQVLLPAIKIWCDWMLCHSTVWNPPPSCTDYRVGPPGD… |
| A0A444T0D9 | 11-194 | None |
| A0A0R4IZ84 | 1079-1354 | None |
| A0A7R9IZE3 | 2-244 | None |
| A0A1S3ZP53 | 65-332 | None |
| A0A182FJ63 | 48-355 | None |
| A0A151I0W9 | 27-378 | None |
| A0A183VMB0 | 143-444 | None |
| A0A5B7EJU5 | 46-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.