DPCstruct | MC30812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 132 ± 20 aa |
| Standard deviation of domain lengths | 20.49 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834N182 | 1-125 | MLGEKVTQVPRPSLSNYLKRVKAEPRASLVQLASLYDALGKDARKQGYGKYFGYSDEVLQVLDTSAEGGIGPQLKKLLDKVLERNEL… |
| A0A7R8UVM1 | 591-702 | GRYHPISGKKRIPPTKPYVEFLMLYDLLKREAKSLNLTIYEGYSEKMIEELSATSKRSAEIQLHILMTRMLEQKEVKRNDVTSRIKS… |
| A0A194Q1T4 | 385-504 | None |
| B0X5L8 | 165-291 | None |
| A0A1I8P792 | 176-313 | None |
| A0A6P8YC89 | 276-452 | None |
| I4DJM1 | 97-213 | None |
| A0A084VRE3 | 160-278 | None |
| A0A811X301 | 236-404 | None |
| A0A067QY21 | 56-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.