DPCstruct | MC3081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 419 |
|---|---|
| Mean domain length (aa) | 114 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.73 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | CL0328- CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3LWA8 | 7-120 | LCCAAALALGADGTAKYFDSPAKYFDKKVAPILTRRCLGCHNDELKDGGISFQDRPSLLKGGGRGPAIVPGKPAASMLVVALRHEGE… |
| A0A7C5R8G8 | 24-100 | VSYAQTIKPIIMNNCAVSGCHNGTQFPDFRSLSNIQQNKDQIRQRTQTGNMPPNGRSLTQQQIDLIACWIDDGALDN |
| A0A2A2YAZ9 | 16-129 | None |
| A0A7Y3V1K8 | 51-162 | None |
| A0A150PG79 | 189-296 | None |
| A0A7Y7NTU9 | 36-138 | None |
| A0A3A5GH71 | 430-534 | None |
| A0A534C0G6 | 46-141 | None |
| A0A3C1KTX4 | 377-456 | None |
| A0A539E3R4 | 13-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.