DPCstruct | MC30802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 368 |
|---|---|
| Mean domain length (aa) | 105 ± 20 aa |
| Standard deviation of domain lengths | 20.31 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.31 |
| Pfam Score | 99.79 |
| Assigned Pfam label(s) | CL0016- CL0417 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1Y7Z0 | 8-109 | SNKNNDHVCNPAYPQYATTSARLITFKEWPKSLPVKPEDLADAGFFYTGRSDKTLCFYCGGGLRDWKDNDNPWEEHAVWFARCKFLL… |
| A0A0J0XIE8 | 2-91 | QRLEARVASFSAVVRPKRAAKPAWPLARDTHPALTPAALAAAGFYHTPVAGEEDACMCFLCPLALSGWDAGDNPHVEHVGRDTPCAW… |
| A0A1Y1V707 | 91-200 | None |
| A0A182YU47 | 142-309 | None |
| A0A2C9JC18 | 177-270 | None |
| A0A182YU10 | 112-229 | None |
| A0A182YTQ8 | 231-338 | None |
| A0A2C9JCB2 | 686-786 | None |
| A0A2H9T8A6 | 633-755 | None |
| B6K6S4 | 19-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.