DPCstruct | MC308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 609 ± 92 aa |
| Standard deviation of domain lengths | 91.54 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A0DVT2 | 4-654 | PKQPHDIESGRRALAPYNFVPLPERVVTLAMKDLPDQGIYGKDHDGKNLLSGYLDCELTTASPLYVRAGITPQYFQLGKDTKDQSDF… |
| A0A6G5QPX3 | 3-545 | TAPYNFVPLNDKIFYPPWVGEDILKNIHDVPFKDGESGVIELEVTAKSSIFIKDSKNPSEFCHFINEKDAKEYYIPATSIKGMIRNV… |
| A0A7Z9YW83 | 507-1221 | None |
| A0A845Y3E8 | 1-748 | None |
| A0A448MZP5 | 2-654 | None |
| A0A1M3MB04 | 72-644 | None |
| A0A3D3MYQ9 | 2-610 | None |
| A0A399HZR1 | 3-708 | None |
| A0A1W9TK79 | 105-735 | None |
| A0A521LYC2 | 124-794 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.