DPCstruct | MC30797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 183 ± 24 aa |
| Standard deviation of domain lengths | 23.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.07 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | CL0167- CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1XHV0 | 64-241 | GGAVPAGAHSYERDAYGNEVGVSARRLPVAYLLVDVPCGLAAGGAPTLHASAFPPAHRPLAAHLQTLRALHQHLRAAPTFLDAVSDL… |
| A0A0N4Y2T3 | 316-465 | REKPLCESQYITDVQYTEKNQYGAEVLKDARPLPVEFLLVDVPTGMPKDPQYTFSPPSRTAPFAIENRDAAGIMQGGANMAAYCAEY… |
| A0A4P9Y591 | 348-549 | None |
| A0A7R9AQH7 | 872-1078 | None |
| A0A1I8FPN2 | 180-348 | None |
| A0A482VDH4 | 5-152 | None |
| A0A4Y7LE16 | 66-241 | None |
| A0A151LFG7 | 414-603 | None |
| A0A4U0XSZ4 | 416-603 | None |
| A0A4Y2UJP9 | 145-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.