DPCstruct | MC30791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 254 ± 48 aa |
| Standard deviation of domain lengths | 48.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.54 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF14688- PF14687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2VC60 | 84-357 | VCIVFSLKSPDNYVAEDGCIVLSVQRMPAWEEFLLTLPQEVWQNCVQMHRDWRIGNAPKLRARQRQLMKVADMFHFFRLQLDSGIGS… |
| A0A835T9H6 | 447-746 | ANLRGALRLHHEVMASFADKQLAPALQVALLERLAKVVDAVARSARVRLGGCHIVIGDRLGLDRLGHLCLAAHEDDAAWRAFLTGVD… |
| A0A5B8MD28 | 172-447 | None |
| A0A1I8FNL2 | 131-340 | None |
| A9TB64 | 186-488 | None |
| A0A3S1B473 | 3-211 | None |
| F4PVU4 | 403-689 | None |
| A0A5E4QDR1 | 2-194 | None |
| G1T5J2 | 299-569 | None |
| D3B887 | 218-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.