DPCstruct | MC30788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 254 ± 52 aa |
| Standard deviation of domain lengths | 52.38 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P3Z2L3 | 185-433 | ALVADEAFARLAAEHADLACDPKRNAAALRGVEDAMNECGDAVAAALRHAALMRDLASRYPFLRLHEEEGWPEALVADEAFARLAAE… |
| A0A2V2V1C9 | 50-336 | RRRRGAVRARAMELGSAKLQATEEEQRKYPFLPRRVDDVLMSDLRLAEDGVFQELVARRDALVAAGPGSNPELLTATERQLRGRASE… |
| A0A2V2VKQ6 | 14-229 | None |
| A0A836GZ49 | 149-499 | None |
| A0A2V2VIY2 | 2-160 | None |
| A0A836HK70 | 10-389 | None |
| A0A836HRE6 | 1-272 | None |
| A0A6L0XH57 | 116-299 | None |
| A0A6L0XHU8 | 45-272 | None |
| A0A7G2CRB3 | 2-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.