DPCstruct | MC30785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0D7W6 | 1-67 | PATLARRGPGGGRGRGVIGWAGPWPLAERWWTDEPRYRTHLQVALEDGSALLLAHTAETWTCEAVYD |
| A0A433FLX1 | 1-59 | ERGGRFASVTAWAGPWPLVVRWWEAGGRRLHRLQLVDDDGRAWYLVLADHRWWAEAVAT |
| A0A6I3IL04 | 134-194 | None |
| U0FM39 | 3-52 | None |
| A0A6J7I3G8 | 280-340 | None |
| A0A4S8QBZ7 | 397-459 | None |
| A0A7C6MHW0 | 21-86 | None |
| A0A257RK38 | 307-359 | None |
| W4UMI1 | 80-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.