DPCstruct | MC30782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 108 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 19.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0634 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6IYP2 | 12-109 | VTPEELEEANRIGRTLLYLRVTLIPDCTQKLERFRLIDMKLSAYEQVLDRTPNLSDPAEPLESIESVTWLIAFAGEAKHLQRWVELM… |
| A0A3Q9I639 | 3-114 | QAGLQILEYPDVSDKELREAMMAGMRVINLQVALSLECEQPLLRICMIDAKLRAVHQVFDSNPKVPMWLGKEASSEVYHTSWLIAVD… |
| A0A2C1K4M3 | 1-106 | None |
| A0A3F3S4J5 | 136-248 | None |
| A0A1F9MDG0 | 7-105 | None |
| A0A0B0I880 | 148-248 | None |
| A0A1V5URZ3 | 726-832 | None |
| A0A4Y1Z6M3 | 57-168 | None |
| A0A3E0KDL5 | 149-263 | None |
| A0A7V1HZD1 | 592-704 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.