DPCstruct | MC3078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 16.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7NAS7 | 1-82 | MIHMSQSLGVNCTFCHNSRSFGDWTQSPPQRTPAWHGIRMTRMINQDHLKPLTDVFPENRLGPLGDVAKVNCSTCHQGVNKP |
| A0A2U3LLP6 | 12-117 | LPLCAQDAPPKQKQEAPPPTNLKVLKVTTSAEIRQIMRTFTVGLGVQCAYCHVMGNFASDENPKKEMARHMIQMAQKINAEFPDGKM… |
| A0A2V9T4T7 | 26-146 | None |
| A0A2N9L487 | 2-128 | None |
| A0A534PAS3 | 85-198 | None |
| A0A2V8I133 | 350-468 | None |
| A0A7V0Y5S8 | 110-218 | None |
| A0A1Q7YRD6 | 89-192 | None |
| A0A523D9P6 | 3-72 | None |
| A0A5A7NAE9 | 72-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.