DPCstruct | MC30772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 225 ± 51 aa |
| Standard deviation of domain lengths | 50.81 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 67.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A291T213 | 114-244 | EDRQLLIRSFRGLPERWQIVLWLTLVEEEPPHRVAMVLNISPSGVTSLAFRAREGLRRSYLRAHLESAHDNRCRHYSGQIGASVRRG… |
| A0A6N7L0M9 | 2-186 | LAAEEGSLVPRAFRSLPERWQAVLWHALVEHEPAAATARRLGITACGIGSLVVRAREGLREAYLRAHLDQTTSEECRHFGVLLAASI… |
| A0A0Q4DFS8 | 61-267 | None |
| A0A397LL36 | 2-347 | None |
| A0A0S7WKA3 | 9-284 | None |
| A0A846U1A3 | 142-362 | None |
| A0A0W7WB41 | 74-315 | None |
| A0A498AY44 | 301-544 | None |
| A0A7Y6E4R5 | 9-244 | None |
| A0A0Q8LUB6 | 60-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.