DPCstruct | MC30771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 116 ± 21 aa |
| Standard deviation of domain lengths | 20.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03640 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7KYZ8 | 7-108 | TAATATVVHNAAGFTLYRFDKDIAKPSKSNCHDACATTWPPALVQPGSRIFVDGVPTSEIGIVDRADGTRQVTIGGWPVYRFSKDTA… |
| A0A1F6MCD0 | 24-129 | ATLKVGDSSLGKILVANNGMTLYLKKDDSTGKSTCYGDCAKNWPPLLVKVIPTAGTGVTGKVDRTVRTDGRFQVTYNGMPLYFWKSD… |
| A0A158G6S4 | 11-121 | None |
| A0A1Q6XGT4 | 7-100 | None |
| A0A2G4IIK2 | 20-133 | None |
| A0A136I190 | 76-173 | None |
| A0A7Y0L7D9 | 1-131 | None |
| A0A5P2QM46 | 11-123 | None |
| A0A1I0DPI2 | 338-435 | None |
| A0A1E7YTJ8 | 15-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.