DPCstruct | MC30770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 142 ± 20 aa |
| Standard deviation of domain lengths | 19.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7KX80 | 17-135 | EPGFGAVLLKLAHSRNLTWTSTAKALYAVTGGRIYLSPSTIGGIGRGTVKATPELVAGLAGVLGIPTPDLAALGGIHLPDDLAPLHS… |
| A0A810N9G7 | 80-223 | PARPILLAAARAMPQQPLVGPLPPPLRPFPEDRAGAIIGRLLHHRNFKGTSAVELLLYSGGPYLSVPTVNQIALGGRALDPQLVSGF… |
| A0A4R7BXK0 | 54-170 | None |
| A0A0D0PQI2 | 44-177 | None |
| A0A1I6FC65 | 23-184 | None |
| A0A1V2P4M8 | 60-190 | None |
| A0A1H5E5N6 | 41-229 | None |
| A0A2T0K1E3 | 66-223 | None |
| U5W3F2 | 71-215 | None |
| A0A1K2FPD5 | 222-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.