DPCstruct | MC3077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9D701 | 3-91 | RTSTREVLVVALRNGILPQQVPVAEVLSSAELARFGLPTEAQVRLPDTVVYSTAHSALFFIDIGPIDSSRLAELKEWSNTALYPRVY… |
| A0A2U3LHL1 | 1-108 | MGGRHNQLQKAIIEQFLPRFGHGAEVLYVGDTANKYAFINRERLARLKCFDIEESKLPDVLAYSESENWIFLIEAVYSSGPISSERR… |
| A0A3D2G907 | 16-140 | None |
| A0A6L8FY67 | 471-576 | None |
| A0A1E3XBH1 | 65-190 | None |
| A0A1X0ECH9 | 196-323 | None |
| A0A7X7E1U2 | 1-115 | None |
| A0A843GL51 | 31-145 | None |
| A0A829BAZ1 | 17-139 | None |
| A0A831X152 | 127-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.