DPCstruct | MC30769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 14.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04927 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I4FRZ7 | 17-122 | LLQKPITYGNIFGAVGKLGSDSVLPEDAALMQSAEARTFGQTQKDGAASVMQAAAELNVKAGFVEKDAHSQVAEKGVMAQEILVPGA… |
| A0A2S1WLT8 | 18-174 | QPQQGQQGTAPAAAQQGPIKYGDAFNVKGELAGQPIAPQDAAAMRSAEQSIPGVQVPQEKGGGFSAGGFMESAAQYNQAVGAVQPGQ… |
| A0A445CKK4 | 2-140 | None |
| A0A843WPS9 | 1-127 | None |
| A0A287X305 | 1-134 | None |
| A0A1U8P0B3 | 64-225 | None |
| A0A5B6VZT2 | 200-327 | None |
| A0A3L6PBC5 | 23-138 | None |
| A0A5B6VQB7 | 391-519 | None |
| A0A0P0YA29 | 3-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.