DPCstruct | MC30766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 556 ± 75 aa |
| Standard deviation of domain lengths | 75.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11882- PF07923 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369S8T2 | 1-547 | MDGTEAPQKANAGPHIKNLSKLRELLRAQKRELEEPDTPEIEFAYKDTNSYLTQLGEYYSYLEHTEFLEYRLCYEEYKLAIGNALND… |
| A0A4C1VJ83 | 1-544 | MPDIRRPMEEGDSVNDVESPELDFEYDDCDCQANEIAELYSYTEHPEFQLNVKAFEDIMEEFNFPPSWQRLTKEQQKTIVMKLLEHL… |
| A0A1I8IRI2 | 2-542 | None |
| A0A834CV74 | 525-1094 | None |
| A0A5K3FGP0 | 1-595 | None |
| X0BC34 | 24-610 | None |
| A0A3M6V3R6 | 28-473 | None |
| A0A7R9BGX8 | 197-798 | None |
| A0A672RUJ4 | 13-440 | None |
| A0A4S3JRS9 | 29-750 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.