DPCstruct | MC30765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 123 ± 15 aa |
| Standard deviation of domain lengths | 14.51 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.73 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | PF14645- PF04281 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803W7M6 | 227-350 | RRAMPLFGNSFSPKKTPPRKWSSLSNLHLMDRSTREVELGLEYGTPTMNLAGQSLKFENGHWVSESGSFTGDRRELQRLRKRNQQLE… |
| A0A4C1VBP3 | 19-168 | ETARGQSNKFSPKKIPVRKIDTHILKKELGNEYASKELSLDVGPLKLKLGDFEISFEDGQWIPVSGRAGAAHKENVELKKELQQLEE… |
| A0A6J3H7G0 | 30-164 | None |
| A0A814B7J8 | 46-152 | None |
| A0A3P8Z2I5 | 12-140 | None |
| A0A819F6P8 | 1-111 | None |
| A0A7M3RHV3 | 139-280 | None |
| I3NHL2 | 1-96 | None |
| A0A7J6ZFS8 | 76-178 | None |
| A0A674CK50 | 3-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.