DPCstruct | MC30764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 194 ± 40 aa |
| Standard deviation of domain lengths | 39.70 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.81 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | PF01997- PF13821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1VAC7 | 4-195 | LNSKEQAAKTVEEATERLNKLVRGPIKRIALELENSPAYLHSRAVSPGLQEFIEARTYCHWMQYQTLVSCSEVQKEFEHVIKEKCDE… |
| R1FTZ2 | 18-184 | ENKKDKIIELGIKLNRTSKSIIYSVIRGDIKSANEYMVEMDKYKEEIDKIVREEPRLYNNALINYQEYAEAKIFYNFILNNKIPKND… |
| A0A0B3B010 | 9-121 | None |
| A0A3D8SJN1 | 233-467 | None |
| A0A1D6GQ32 | 55-263 | None |
| A0A662WEQ1 | 189-308 | None |
| A0A7E4SBT7 | 1-114 | None |
| A0A7K4AJC5 | 2-118 | None |
| A0A3P6C0Z0 | 117-328 | None |
| A0A3M7MAG9 | 143-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.