DPCstruct | MC30761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 173 ± 24 aa |
| Standard deviation of domain lengths | 24.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1UY10 | 10-175 | MRNAFLEFAAITIAIQDVTQTMCKNILHIYKKGDIEQLKQKLEENEGTIYNNKSSQYILGDARQNMAAYNDTCGLVYLDEQSKKITG… |
| A0A811WCV3 | 21-166 | NAVIEFVAITTATKQVNLLSCKTIMQTYRQENEGGLKILLEEAEACIYDNSSCQVLRGKMTGAYMAAYSEESGFVPWECNSSKFTVP… |
| A0A4C1TE87 | 10-175 | None |
| A0A835G8D7 | 307-453 | None |
| A0A2W1BQE5 | 41-198 | None |
| A0A2W1BNQ4 | 44-210 | None |
| A0A482WP41 | 17-224 | None |
| A0A4C1Z777 | 69-251 | None |
| A0A4C1TIT3 | 154-321 | None |
| A0A4C1VR45 | 190-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.