DPCstruct | MC30760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 210 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05731 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8BJI9 | 1-218 | MGISNWYNGFKSEDPQNHKSAKKLAYFVTKYKRRHGWTHRDAIRLAHVHPKTTNIRLIIEYIFGKNIIVNTTPNQASISEFLDAARK… |
| A0A5E4ASM4 | 314-508 | WGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALTVETEKLLKYLE… |
| A0A8B6HP81 | 3-202 | None |
| H3DU13 | 244-453 | None |
| A0A498N4K4 | 134-334 | None |
| K1Q6Y1 | 95-315 | None |
| K1Q171 | 351-538 | None |
| A0A3Q0JBI5 | 136-363 | None |
| A0A813M443 | 316-494 | None |
| A0A819KT28 | 7-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.