DPCstruct | MC30754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 221 ± 22 aa |
| Standard deviation of domain lengths | 21.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3CJ36 | 6-247 | LQRDVIYNKFAALHLPTLVDHFLEPPSLPPTFPQDMVDDFKVNNTYIEMIGAISHTPYFAKYFRSQLPSAEGGKRLLRVLAQRLVEL… |
| A0A067QBS0 | 64-271 | EQQEIIFSRFTAFYILKLLEKWRAADDPNSPYFTMLNHIVDNPYFHIFFSSDHPASKGITLLHAQRLDKVAWNSVDDEDGVFHGCQF… |
| B0DCQ3 | 70-259 | None |
| A0A165K190 | 112-364 | None |
| A0A4Y7TV57 | 4-189 | None |
| A0A0C2YJG0 | 11-243 | None |
| A0A5C3L251 | 68-267 | None |
| A0A165K183 | 33-270 | None |
| A0A166H4E3 | 71-301 | None |
| A0A2H3DFE0 | 48-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.