DPCstruct | MC30750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 160 ± 38 aa |
| Standard deviation of domain lengths | 38.23 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 91.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9KT87 | 45-210 | DTQPHGLCGSGLIDLLAELRRYDQMTPKGVFADKKQYELTVVPEYGITLSREDASNLAQAKAANYCGQFILIRHFGISPLDITECYL… |
| A0A7V4CGX6 | 164-305 | SYLADLIKEGIVDKSGKLKRKNPYFSQKDIRELQLAKSAIASGIIILSKISGIPLFQIENVYLTGNFGSKIDIEDLYTIGILPKEIK… |
| A0A3C1BU99 | 23-218 | None |
| R5VMX7 | 303-464 | None |
| A0A7W0HJS3 | 195-435 | None |
| A0A7X9BVB1 | 12-178 | None |
| A0A7C2WX15 | 195-422 | None |
| A0A7V0T952 | 27-197 | None |
| A0A7K2BMX2 | 204-378 | None |
| A0A2E5Q4B2 | 22-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.