DPCstruct | MC3075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 150 ± 24 aa |
| Standard deviation of domain lengths | 23.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1GYI8 | 8-151 | ISGKQDRLAEEILARAPRHIEQSFVNSLDPAAALALGRYGARLATLALRQNSVDLLRRSVLATSLARCLASDDDRDFMVALAVPWIV… |
| A0A2U3KVW9 | 29-172 | VDGIMAALIEAFRSADVNQRRAATEALTVDAELLLLSYAWESAAEAVRRSAPSILADGLAALSIENGRYDARDSIVQMAVLFRSAEK… |
| A0A4S8HTT6 | 4-166 | None |
| A0A6J7H7G5 | 5-106 | None |
| A0A7D8IKX4 | 3-175 | None |
| A0A842MBC8 | 1-173 | None |
| A0A7W0AP80 | 10-174 | None |
| A0A0N8WJ20 | 11-133 | None |
| A0A100J997 | 1-116 | None |
| A0A1F2WYV3 | 33-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.