DPCstruct | MC30749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 157 ± 15 aa |
| Standard deviation of domain lengths | 15.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18927 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3ZXR6 | 1-160 | MQLLIFNFLFWLVLMFFAGIIVHFIPPEFYDPENFLFKPRKIEFDGKLYTSLFAIKKWKDRLPECGEFFKFNPFNKKRLQKMKDLNY… |
| A0A1C6FNA5 | 10-163 | ALLINLLLGTIWHYATFFLCISIKIEHFDSKRARYQPRKWEKNGKWYADHLKINKWKDFLPQHIGKDGFSKDHLDDVSIEYLDEFIL… |
| A0A1H5VYW6 | 4-144 | None |
| R5D8Q7 | 1-151 | None |
| A0A3G6UU84 | 5-157 | None |
| A0A1B3WQ00 | 3-158 | None |
| A0A172TPT1 | 2-138 | None |
| A0A521XNW4 | 8-180 | None |
| A0A3D0M8S6 | 40-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.